| Edit |   |
|---|
| Antigenic Specificity | Uroporphyrinogen Decarboxylase (UROD) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | UROD is the fifth enzyme of the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria. |
|---|
| Immunogen | UROD antibody was raised using the N terminal of UROD corresponding to a region with amino acids SLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQV |
|---|
| Other Names | UROD|pct|wu:fc43e09|PCT|UPD|AI323803|Uro-d|porphyrinogen carboxy-lyase |
|---|
| Gene, Accession # | Gene ID: 7389 |
|---|
| Catalog # | ABIN629827 |
|---|
| Price | |
|---|
| Order / More Info | Uroporphyrinogen Decarboxylase (UROD) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|