| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ABCC1 (AA 1-33) |
|---|
| Clone | CBFYM-0809 |
|---|
| Host Species | Recombinant Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG1 |
|---|
| Format | unconjugated |
|---|
| Size | n/a |
|---|
| Concentration | n/a |
|---|
| Applications | WB, IF |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Mouse Anti-ABCC1 (AA 1-33) Recombinant Antibody (CBFYM-0809). This product is mouse antibody that recognizes ABCC1. The antibody CBFYM-0809 can be used for immunoassay techniques such as: WB, IF. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies. This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate |
|---|
| Immunogen | Recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. |
|---|
| Other Names | ATP Binding Cassette Subfamily C Member 1; ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1; Leukotriene C(4) Transporter; LTC4 Transporter; MRP1; MRP; ATP-Binding Cassette Transporter Variant ABCC1delta-Ex13&14; ATP-Binding Cassette Transporter Variant ABCC1delta-Ex25&26; ATP-Binding Cassette Transporter Variant ABCC1delta-Ex13; ATP-Binding Cassette Transporter Variant ABCC1delta-Ex25 |
|---|
| Gene, Accession # | Gene ID: 4363, UniProt: P33527 |
|---|
| Catalog # | CBMAB-M0954-FY |
|---|
| Price | |
|---|
| Order / More Info | ABCC1 (AA 1-33) Antibody from CREATIVE BIOLABS |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|