| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ARID1A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (predicted: hamster) |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for AT-rich interactive domain-containing protein 1A(ARID1A) detection. Tested with WB in Human. No cross reactivity with other proteins. AT-rich interactive domain-containing protein 1A, also known as p270, is a protein that in humans is encoded by the ARID1A gene. This gene encodes a member of the SWI/SNF families, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. ARID1A is mapped to 1p36.11. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human ARID1A (1021-1053aa KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR), identical to the related mouse sequence. |
|---|
| Other Names | AT-rich interactive domain-containing protein 1A;ARID domain-containing protein 1A;B120;BRG1-associated factor 250;BAF250;BRG1-associated factor 250a;BAF250A;Osa homolog 1;hOSA1;SWI-like protein;SWI/SNF complex protein p270;SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1;hELD;ARID1A;BAF250, BAF250A, C1orf4, OSA1, SMARCF1; |
|---|
| Gene, Accession # | ARID1A, UniProt: O14497 |
|---|
| Catalog # | PB9685 |
|---|
| Price | |
|---|
| Order / More Info | ARID1A Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|