Arf6 Protein Δ12 Q67L mutant [10125] [10 µg] | | | Catalog Number: 10125 | | Product Name: Arf6 Protein Δ12 Q67L mutant | | Synonyms: ADP-ribosylation factor 6 | | Source: Human, recombinant, His6-tag | | Expression Host: E. coli | | Molecular Weight: 20 kDa | | Purity: >95% by SDS-PAGE | | Introduction: Arf6 is a member of the ARF super-family. ARF genes encode small GTPases that increase the ADP-ribosyltransferase activity of cholera toxin and are critical for vesicular trafficking as activators of phospholipase D. Arf6 regulates membrane trafficking and the actin cytoskeketon at the plasma membrane and functions as a regulatory molecule of phagocytosis. | | Amino Acid Sequence (1-175, Δ12, Q67L) | MGKVLSKIFGN-EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGL DKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHE IQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS | Properties | | Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. | | Physical Appearance (form): White or clear | | Concentration: 1mg/mL | | Storage: -80°C |  | References: 1. Geppert, M. et al., Nature 387: 810-814, 1997. 2. Giovedi, S. et al., J. Biol. Chem. 279: 43769-43779, 2004. 3. Huang, Y.-Y. et al., Proc. Nat. Acad. Sci. 102: 9365-9370, 2005. 4. Kapfhamer, D. et al., Nature Genet. 32: 290-295, 2002. 5. Rousseau-Merck, M. F. et al., Genomics 5: 694-698, 1989. 6. Rousseau-Merck, M. F. et al., Cytogenet. Cell Genet. 51: 1070-only, 1989. 7. Sullivan, M. et al., Cell. Signal. 11: 735-742, 1999. 8. Trask, B. et al., Genomics 15: 133-145, 1993. 9. Zahraoui, A. et al., J. Biol. Chem. 264: 12394-12401, 1989. | | |