Product Overview Stemgent® Sox2-11R is a full-length recombinant human protein fused to an eleven arginine (i.e., 11R) membrane penetration domain at the C terminus to enable penetration across the plasma membrane of mammalian cells. The protein was expressed in E. coli as inclusion bodies, solubilized, refolded, and further purified. The protein identity was confirmed by western blot analysis. The in vitro function was tested using specific DNA binding assays. 11R proteins were reported to successfully generate induced pluripotent stem (iPS) cells from OG2 MEFs1.

Product Specifications

Source	E.coli expressed recombinant human protein.
Purity	Greater than 90%.
Formulation	1 mg/ml in sterile-filtered solution in 20 mM Tris, pH 7.5. Proprietary formulation of NaCl , KCl, EDTA, arginine, DTT, and glycerol.
Amino Acid Sequence	MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDR VKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWK LLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLM KKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSY AHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRY DVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM GSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPG AEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHMESG GGGSPGRRRRRRRRRRR
Uniprot Accession Number	NP_003097.1
Cellular Toxicity	Cellular toxicity of recombinant protein was tested on mouse embryonic stem cells up to 50 µg/ml in culture medium.
Bilogic Activity	Measured by EMSA DNA specific binding assay.
Storage and Handling	Stemgent® Recombinant Human Sox2-11R is stable for six months at -20°C to -80°C. Store thawed tube at 4°C for seven days. Multiple freeze/thaw cycles may result in significant loss of activity.
Usage Note	Hongyan Zhou and colleagues in the Sheng Ding laboratory at The Scripps Research Institute demonstrated the use of recombinant transcription factor proteins to generate protein-induced pluripotent stem (piPS) cells1. Reprogramming with recombinant proteins is still an undeveloped technology and the subject of ongoing research investigations. Scientists in Sheng Ding’s laboratory and at Stemgent have developed an optimized suggested method based on the original publication. Due to the low efficiency, further optimization is required in the experimental design.
Related Products	Stemgent® Affinity Purified anti-Human SSEA-3 Antibody (Cat.No.09-0014) Stemgent® Phycoerythrin (PE) anti-Human SSEA-4 Antibody (Cat.No.09-0003) Stemgent® Affinity Purified anti-Human TRA-1-60 Antibody (Cat.No.09-0010) Stemgent® Affinity Purified anti-Human TRA-1-81 Antibody (Cat.No.09-0011) Stemgent® Purified Rabbit anti-Mouse/Human Oct4 Antibody (Cat.No.09-0023) Stemgent® Purified Mouse anti-Human c-Myc Antibody (Cat.No.09-0032) Stemgent® Purified Mouse anti-Mouse/Human Klf4 Antibody (Cat.No.09-0021) Stemgent® Purified anti-Mouse/Human Sox2 Antibody (Cat.No.09-0024) Stemgent® StainAlive™ DyLight™ 488 Mouse anti-Human TRA-1-60 Antibody (Cat.No.09-0068) Stemgent® StainAlive™ DyLight™ 488 Mouse anti-Human TRA-1-81 Antibody (Cat.No.09-0069) Stemgent® Alkaline Phosphatase Staining Kit (Cat.No.00-0009) Stemgent® Alkaline Phosphatase Staining Kit II (Cat.No.00-0055) Stemolecule™ SB431542 (Cat.No.04-0010) Stemolecule™ PD0325901 (Cat.No.04-0006) Stemolecule™ Thiazovivin (Cat.No.04-0017) Stemedia™ NutriStem™ XF/FF Culture Medium (Cat.No.01-0005) Stemfactor™ Fibroblast Growth Factor-basic (Human Recombinant) (Cat.No.03-0002) Stemgent® Human Foreskin Fibroblasts BJ (Cat.No.08-0026) Stemgent® Reprogramming Adenovirus Set: Mouse OKSM (Cat.No.00-0008) Stemgent® Reprogramming Ecotropic Retrovirus Set: Mouse OSKM (Cat.No.00-0042)