Arf1 Protein Δ17 mutant [10122] [10 µg] | | | Catalog Number: 10122 | | Product Name: Arf1 Protein Δ17 mutant | | Synonyms: ADP-ribosylation factor 1 | | Source: Human, recombinant, His6-tag | | Expression Host: E. coli | | Molecular Weight: 21 kDa | | Purity: >95% by SDS-PAGE | | Introduction: Arf1 is a member of the ARF super-family. ARF genes encode small GTPases that increase the ADP-ribosyltransferase activity of cholera toxin and are critical for vesicular trafficking as activators of phospholipase D. Arf1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. | | Amino Acid Sequence (1-181, Δ17) | MGNIFANLFKGLFGKK-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWD VGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAM NAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK | Properties | | Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. | | Physical Appearance (form): White or clear | | Concentration: 1 mg/mL | | Storage: -80°C | Preparation Instructions: Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles. |  | References: 1. Amor, J. C. et al., Nature 372: 704-708, 1994. 2. Bobak, D. A. et al., Proc. Nat. Acad. Sci. 86: 6101-6105, 1989. 3. Hirai, M. et al., Genomics 34: 263-265, 1996. 4. Kumari, S. et al., Cell Biol. 10: 30-41, 2008. 5. Lee, C.-M. et al., J. Biol. Chem. 267: 9028-9034, 1992. 6. Mossessova, E. et al., Cell 92: 415-423, 1998. 7. Peng, Z. G. et al., Biofactors 2: 45-49, 1989. 8. Presley, J. F. et al., Nature 417: 187-193, 2002. 9. Renault, L. et al., Nature 426: 525-530, 2003. | | |