Edit |   |
Antigenic Specificity | Leucine Rich Repeat Transmembrane Neuronal 1 (LRRTM1) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | LRRTM1 may play a role during the development of specific forebrain structures by influencing neuronal differentiation and connectivity, with a possible role in intracellular trafficking within axons. |
Immunogen | LRRTM1 antibody was raised using the middle region of LRRTM1 corresponding to a region with amino acids CALASWLNNFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSG |
Other Names | im:6904481|4632401D06Rik|AW125451 |
Gene, Accession # | Gene ID: 347730,74342,679668 |
Catalog # | ABIN635753 |
Price | |
Order / More Info | Leucine Rich Repeat Transmembrane Neuronal 1 (LRRTM1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |