Edit |   |
Antigenic Specificity | IRS1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | Protein A purified |
Size | 100 ul |
Concentration | n/a |
Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The IRS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IRS1. This antibody reacts with human. The IRS1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RKRTHSAGTSPTITHQKTPSQSSVASIEEYTEMMPAYPPGGGSGGRLPGHRHSAFVPTRSYPEEGLEMHPL |
Other Names | HIRS-1, insulin receptor substrate 1, IRS-1 |
Gene, Accession # | IRS1, Gene ID: 3667 |
Catalog # | NBP2-68666 |
Price | |
Order / More Info | IRS1 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |