| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NBR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NBR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NBR1. This antibody reacts with human. The NBR1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human NBR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFR |
|---|
| Other Names | Cell migration-inducing gene 19 protein, FLJ98272, KIAA0049CA125, M17S2FLJ55359,1A1-3B, Membrane component chromosome 17 surface marker 2,1A13B, membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigenCA125), migration-inducing protein 19, neighbor of BRCA1 gene 1, Neighbor of BRCA1 gene 1 protein, next to BRCA1 gene 1 protein, Protein 1A1-3B |
|---|
| Gene, Accession # | NBR1, Gene ID: 4077 |
|---|
| Catalog # | NBP2-58516 |
|---|
| Price | |
|---|
| Order / More Info | NBR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|