Edit |   |
Antigenic Specificity | Lysozyme-Like 6 (LYZL6) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | LYZL6 belongs to the glycosyl hydrolase 22 family. The exact function of LYZL6 remains unknown. |
Immunogen | LYZL6 antibody was raised using the N terminal of LYZL6 corresponding to a region with amino acids MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCL |
Other Names | LYC1|PRO1485|TKAL754|UNQ754|1700023H08Rik|Lyc1|RGD1306968 |
Gene, Accession # | Gene ID: 57151 |
Catalog # | ABIN634036 |
Price | |
Order / More Info | Lysozyme-Like 6 (LYZL6) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |