| Edit |   |
|---|
| Antigenic Specificity | A830053O21Rik |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit polyclonal anti-A830053O21Rik antibody |
|---|
| Immunogen | The immunogen for anti-A830053O21Rik antibody: synthetic peptide directed towards the middle region of mouse A830053O21Rik. Synthetic peptide located within the following region: RKRERPTRSKARRMAANVRERKRILDYNEAFNALRRALQHDLGGKRLSKI |
|---|
| Other Names | BHLHF42, basic helix-loop-helix family, member a9 |
|---|
| Gene, Accession # | Bhlha9, Accession: NM_177182 |
|---|
| Catalog # | TA329615 |
|---|
| Price | |
|---|
| Order / More Info | A830053O21Rik Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|