| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KvBeta3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KvBeta3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KvBeta3. This antibody reacts with human. The KvBeta3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human KvBeta3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('CGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQ',) |
|---|
| Other Names | AKR6A9, K(+) channel subunit beta-3, KCNA3.1B, KCNA3BK+ channel beta-3 subunit, Kv-beta-3, MGC116886, potassium channel, voltage-dependent, beta-3 subunit, potassium voltage-gated channel, shaker-related subfamily, beta member 3, voltage-gated potassium channel subunit beta-3 |
|---|
| Gene, Accession # | KCNAB3, Gene ID: 9196 |
|---|
| Catalog # | NBP2-58857 |
|---|
| Price | |
|---|
| Order / More Info | KvBeta3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|