Edit |   |
Antigenic Specificity | Armadillo Repeat Containing, X-Linked 3 (ARMCX3) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | ARMCX3 is a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. |
Immunogen | ARMCX3 antibody was raised using the middle region of ARMCX3 corresponding to a region with amino acids LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE |
Other Names | ARMCX3|DKFZp459E2029|ALEX3|dJ545K15.2|1200004E24Rik|AI450003 |
Gene, Accession # | Gene ID: 51566 |
Catalog # | ABIN635988 |
Price | |
Order / More Info | Armadillo Repeat Containing, X-Linked 3 (ARMCX3) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |