Edit |   |
Antigenic Specificity | Armadillo Repeat Containing 3 (ARMC3) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Armadillo/beta-catenin like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis. |
Immunogen | ARMC3 antibody was raised using the middle region of ARMC3 corresponding to a region with amino acids YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE |
Other Names | MGC76186|CT81|KU-CT-1|4921513G22Rik |
Gene, Accession # | Gene ID: 219681 |
Catalog # | ABIN634605 |
Price | |
Order / More Info | Armadillo Repeat Containing 3 (ARMC3) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |