| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADAMTS18 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADAMTS18 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAMTS18. This antibody reacts with human. The ADAMTS18 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ADAMTS18(ADAM metallopeptidase with thrombospondin type 1 motif, 18) The peptide sequence was selected from the N terminal of ADAMTS18. Peptide sequence FYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISPLPQLLAQEHNYSS |
|---|
| Other Names | A disintegrin and metalloproteinase with thrombospondin motifs 18, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 18, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 21, ADAM metallopeptidase with thrombospondin type 1 motif, 18, ADAM-TS 18, ADAM-TS18, ADAMTS-18, ADAMTS21, disintegrin and metalloprotease-like protein, EC 3.4.24.-, EC 3.4.24.82 |
|---|
| Gene, Accession # | ADAMTS18, Gene ID: 170692, Accession: Q8TE60, SwissProt: Q8TE60 |
|---|
| Catalog # | NBP1-57095 |
|---|
| Price | |
|---|
| Order / More Info | ADAMTS18 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|