| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADAMTS17 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADAMTS17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAMTS17. This antibody reacts with human. The ADAMTS17 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ADAMTS17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QVRRCNLHPCQSRWVAGPWSPCSATCEKGFQHREVTCVYQLQNGTHVATRPLYCPGPRPAAVQSCEGQDCLSIWEASEWS |
|---|
| Other Names | A disintegrin and metalloproteinase with thrombospondin motifs 17, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 17, ADAM metallopeptidase with thrombospondin type 1 motif, 17, ADAM-TS 17, ADAM-TS17, ADAMTS-17, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.80, EC 3.4.24.82, FLJ16363, FLJ32769 |
|---|
| Gene, Accession # | ADAMTS17, Gene ID: 170691 |
|---|
| Catalog # | NBP2-56304 |
|---|
| Price | |
|---|
| Order / More Info | ADAMTS17 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|