| Edit |   |
|---|
| Antigenic Specificity | ANKRD47 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | bovine, human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-ANKRD47 Antibody |
|---|
| Immunogen | The immunogen for Anti-ANKRD47 Antibody: synthetic peptide directed towards the N terminal of human ANKRD47. Synthetic peptide located within the following region: GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR |
|---|
| Other Names | ANKRD47, KN motif and ankyrin repeat domains 3 |
|---|
| Gene, Accession # | KANK3, Accession: NM_198471 |
|---|
| Catalog # | TA333373 |
|---|
| Price | |
|---|
| Order / More Info | ANKRD47 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|