| Edit |   |
| Antigenic Specificity | ZIK1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, bovine, porcine, rat, horse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-ZIK1 Antibody |
| Immunogen | The immunogen for anti-ZIK1 antibody: synthetic peptide directed towards the N terminal of human ZIK1. Synthetic peptide located within the following region: LYLEVMLENFALVASLGCGHGTEDEETPSDQNVSVGVSQSKAGSSTQKTQ |
| Other Names | ZNF762, zinc finger protein interacting with K protein 1 |
| Gene, Accession # | ZIK1, Accession: NM_001010879 |
| Catalog # | TA342130 |
| Price | |
| Order / More Info | ZIK1 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |