| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CHMP4C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CHMP4C Antibody from Novus Biologicals is a rabbit polyclonal antibody to CHMP4C. This antibody reacts with human. The CHMP4C Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CHMP4C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQN |
|---|
| Other Names | charged multivesicular body protein 4c, CHMP4c, chromatin modifying protein 4C, Chromatin-modifying protein 4c, hSnf7-3, hVps32-3, MGC22825, Shax3, SNF7 homolog associated with Alix 3, Snf7 homologue associated with Alix 3, SNF7-3, Vacuolar protein sorting-associated protein 32-3, Vps32-3, VPS32C |
|---|
| Gene, Accession # | CHMP4C, Gene ID: 92421, Accession: Q96CF2 |
|---|
| Catalog # | NBP1-81166 |
|---|
| Price | |
|---|
| Order / More Info | CHMP4C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|