| Edit |   |
|---|
| Antigenic Specificity | TTC19 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-TTC19 Antibody |
|---|
| Immunogen | The immunogen for anti-TTC19 antibody: synthetic peptide directed towards the N terminal of mouse TTC19. Synthetic peptide located within the following region: RTRGAPARGHGVLPLLAALAWFSRPAATAEQPGEDASDEAEAEIIQLLKQ |
|---|
| Other Names | 2010204O13Rik, MC3DN2, tetratricopeptide repeat domain 19 |
|---|
| Gene, Accession # | TTC19, Accession: NM_028360 |
|---|
| Catalog # | TA329950 |
|---|
| Price | |
|---|
| Order / More Info | TTC19 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|