| Edit |   |
|---|
| Antigenic Specificity | Bone Morphogenetic Protein 6 (BMP6) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. |
|---|
| Immunogen | BMP6 antibody was raised using the middle region of BMP6 corresponding to a region with amino acids MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL |
|---|
| Other Names | BMP6|zgc:113595|vgr|vgr-1|vgr1|VGR|VGR1|D13Wsu115e|Vgr1 |
|---|
| Gene, Accession # | Gene ID: 654 |
|---|
| Catalog # | ABIN634774 |
|---|
| Price | |
|---|
| Order / More Info | Bone Morphogenetic Protein 6 (BMP6) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|