| Edit |   |
| Antigenic Specificity | PPME1 - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | bovine, dog, human, mouse, porcine, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-PPME1 Antibody - N-terminal region |
| Immunogen | The immunogen for anti-PPME1 antibody: synthetic peptide directed towards the N terminal of human PPME1. Synthetic peptide located within the following region: MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYF |
| Other Names | PME1, protein phosphatase methylesterase 1 |
| Gene, Accession # | PPME1, Accession: NM_016147 |
| Catalog # | TA345060 |
| Price | |
| Order / More Info | PPME1 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |