| Edit |   |
|---|
| Antigenic Specificity | SEC31B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-SEC31B Antibody |
|---|
| Immunogen | The immunogen for Anti-SEC31B antibody is: synthetic peptide directed towards the middle region of Human SEC31B. Synthetic peptide located within the following region: VGLGESPQPKGNDLNSDRQQAFCSQASKHTTKEASASSAFFDELVPQNMT |
|---|
| Other Names | SEC31B1, SEC31L2, SEC31 homolog B (S. cerevisiae) |
|---|
| Gene, Accession # | SC31B, Accession: NM_015490 |
|---|
| Catalog # | TA331356 |
|---|
| Price | |
|---|
| Order / More Info | SEC31B Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|