| Edit |   |
|---|
| Antigenic Specificity | C9orf43 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, dog, yeast, porcine |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit polyclonal Anti-C9orf43 Antibody |
|---|
| Immunogen | The immunogen for anti-C9orf43 antibody: synthetic peptide directed towards the middle region of human C9orf43. Synthetic peptide located within the following region: PEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE |
|---|
| Other Names | chromosome 9 open reading frame 43 |
|---|
| Gene, Accession # | C9orf43, Accession: NM_152786 |
|---|
| Catalog # | TA330927 |
|---|
| Price | |
|---|
| Order / More Info | C9orf43 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|