| Edit |   |
|---|
| Antigenic Specificity | CAMK1D - N-terminal region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse; human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-CAMK1D Antibody - N-terminal region |
|---|
| Immunogen | The immunogen for Anti-Camk1d antibody is: synthetic peptide directed towards the N-terminal region of Mouse Camk1d. Synthetic peptide located within the following region: LAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIY |
|---|
| Other Names | CKLiK, CaMK1, CaMKID, calcium/calmodulin-dependent protein kinase ID |
|---|
| Gene, Accession # | CAMK1D, Accession: NM_020397 |
|---|
| Catalog # | TA344785 |
|---|
| Price | |
|---|
| Order / More Info | CAMK1D - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|