Edit |   |
Antigenic Specificity | Calmegin (CLGN) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | purified |
Size | 100 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Calmegin is a testis-specific endoplasmic reticulum chaperone protein. CLGN may play a role in spermatogeneis and infertility. |
Immunogen | Calmegin antibody was raised using the N terminal of CLGN corresponding to a region with amino acids YKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEEL |
Other Names | canx|fj49d10|wu:fj24b04|wu:fj49d10|zgc:153946|CLGN|clgn|clnx|cnx|4930459O04Rik|AI528775|Cln |
Gene, Accession # | Gene ID: 1047 |
Catalog # | ABIN630467 |
Price | |
Order / More Info | Calmegin (CLGN) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |