| Edit |   |
| Antigenic Specificity | C20ORF194 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal anti-C20ORF194 antibody |
| Immunogen | The immunogen for anti-C20ORF194 antibody: synthetic peptide directed towards the C terminal of human C20ORF194. Synthetic peptide located within the following region: FVNFFGDKTDFHPLMDQFMNDYVEEANREIEKYNQELEQQEYHDLFELKP |
| Other Names | chromosome 20 open reading frame 194 |
| Gene, Accession # | C20ORF194, Accession: NM_001009984 |
| Catalog # | TA329419 |
| Price | |
| Order / More Info | C20ORF194 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |