| Edit |   |
|---|
| Antigenic Specificity | C20orf166 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-C20orf166 Antibody |
|---|
| Immunogen | The immunogen for Anti-C20orf166 Antibody is: synthetic peptide directed towards the N-terminal region of Human C20orf166. Synthetic peptide located within the following region: QQVARGEPGSARGQLQVSPEMSITHKEKENAHLKEILLFVNAEAFSQPQP |
|---|
| Other Names | MIR11HG, MIR133A2HG, dJ353C17.1, chromosome 20 open reading frame 166 |
|---|
| Gene, Accession # | C20orf166, Accession: NM_178463 |
|---|
| Catalog # | TA333430 |
|---|
| Price | |
|---|
| Order / More Info | C20orf166 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|