| Edit |   |
| Antigenic Specificity | STARD8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-STARD8 Antibody |
| Immunogen | The immunogen for anti-STARD8 antibody: synthetic peptide directed towards the N terminal of human STARD8. Synthetic peptide located within the following region: KKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKVSKASSFRSCRG |
| Other Names | ARHGAP38, DLC3, STARTGAP3, StAR-related lipid transfer (START) domain containing 8 |
| Gene, Accession # | STAR8, Accession: NM_001142503 |
| Catalog # | TA342686 |
| Price | |
| Order / More Info | STARD8 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |