| Edit |   |
|---|
| Antigenic Specificity | STARD7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, porcine, dog, horse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-STARD7 Antibody |
|---|
| Immunogen | The immunogen for anti-STARD7 antibody is: synthetic peptide directed towards the N-terminal region of Human STARD7. Synthetic peptide located within the following region: SINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDK |
|---|
| Other Names | GTT1, StAR-related lipid transfer (START) domain containing 7 |
|---|
| Gene, Accession # | STAR7, Accession: NM_020151 |
|---|
| Catalog # | TA338027 |
|---|
| Price | |
|---|
| Order / More Info | STARD7 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|