| Edit |   |
| Antigenic Specificity | FN3KRP - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | bovine, human, rabbit, rat, zebrafish |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-FN3KRP Antibody - N-terminal region |
| Immunogen | The immunogen for anti-FN3KRP antibody: synthetic peptide directed towards the N terminal of human FN3KRP. Synthetic peptide located within the following region: MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA |
| Other Names | FN3KL, fructosamine 3 kinase related protein |
| Gene, Accession # | KT3K, Accession: NM_024619 |
| Catalog # | TA344259 |
| Price | |
| Order / More Info | FN3KRP - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |