| Edit |   |
|---|
| Antigenic Specificity | PHKG1 - N-terminal region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat; human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-PHKG1 Antibody - N-terminal region |
|---|
| Immunogen | The immunogen for Anti-Phkg1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Phkg1. Synthetic peptide located within the following region: NFYENYEPKEILGRGVSSVVRRCIHKPTCQEYAVKIIDITGGGSFSSEEV |
|---|
| Other Names | PHKG, phosphorylase kinase, gamma 1 (muscle) |
|---|
| Gene, Accession # | PHKG1, Accession: NM_006213 |
|---|
| Catalog # | TA345154 |
|---|
| Price | |
|---|
| Order / More Info | PHKG1 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|