| Edit |   |
|---|
| Antigenic Specificity | PFDN2 - middle region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | bovine, dog, guinea pig, human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-PFDN2 Antibody - middle region |
|---|
| Immunogen | The immunogen for anti-PFDN2 antibody: synthetic peptide directed towards the middle region of human PFDN2. Synthetic peptide located within the following region: LTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLV |
|---|
| Other Names | PFD2, prefoldin subunit 2 |
|---|
| Gene, Accession # | PFD2, Accession: NM_012394 |
|---|
| Catalog # | TA345121 |
|---|
| Price | |
|---|
| Order / More Info | PFDN2 - middle region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|