| Edit |   |
|---|
| Antigenic Specificity | SAMD7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, guinea pig, bovine, horse, dog, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-SAMD7 Antibody |
|---|
| Immunogen | The immunogen for anti-SAMD7 antibody is: synthetic peptide directed towards the middle region of Human SAMD7. Synthetic peptide located within the following region: ESWGQRCRRLRKNTGNQKALDSDAESSKSQAEEKILGQTHAVPYEEDHYA |
|---|
| Other Names | sterile alpha motif domain containing 7 |
|---|
| Gene, Accession # | SAMD7, Accession: NM_182610 |
|---|
| Catalog # | TA334865 |
|---|
| Price | |
|---|
| Order / More Info | SAMD7 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|