| Edit |   |
|---|
| Antigenic Specificity | SALF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal anti-SALF antibody |
|---|
| Immunogen | The immunogen for anti-SALF antibody: synthetic peptide directed towards the C terminal of human SALF. Synthetic peptide located within the following region: NSGDDVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRD |
|---|
| Other Names | SALF, STON1-GTF2A1L readthrough |
|---|
| Gene, Accession # | STON1-GTF2A1L, Accession: NM_172311 |
|---|
| Catalog # | TA329314 |
|---|
| Price | |
|---|
| Order / More Info | SALF Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|