Edit |   |
Antigenic Specificity | EMR3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-EMR3 Antibody |
Immunogen | The immunogen for anti-EMR3 antibody is: synthetic peptide directed towards the C-terminal region of Human EMR3. Synthetic peptide located within the following region: SQQVQKQYQKWFREIVKSKSESETYTLSSKMGPDSKPSEGDVFPGQVKRK |
Other Names | egf-like module containing, mucin-like, hormone receptor-like 3 |
Gene, Accession # | EMR3, Accession: NM_032571 |
Catalog # | TA342888 |
Price | |
Order / More Info | EMR3 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |