| Edit |   |
|---|
| Antigenic Specificity | MTMR10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, guinea pig, horse, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-MTMR10 Antibody |
|---|
| Immunogen | The immunogen for Anti-MTMR10 Antibody is: synthetic peptide directed towards the C-terminal region of Human MTMR10. Synthetic peptide located within the following region: PRRNSLILKPKPDPAQQTDSQNSDTEQYFREWFSKPANLHGVILPRVSGT |
|---|
| Other Names | myotubularin related protein 10 |
|---|
| Gene, Accession # | MTMRA, Accession: NM_017762 |
|---|
| Catalog # | TA331884 |
|---|
| Price | |
|---|
| Order / More Info | MTMR10 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|