| Edit |   |
|---|
| Antigenic Specificity | MTHFD2L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | bovine, dog, human, porcine, rabbit |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-MTHFD2L Antibody |
|---|
| Immunogen | The immunogen for Anti-MTHFD2L Antibody: synthetic peptide directed towards the middle region of human MTHFD2L. Synthetic peptide located within the following region: TGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTP |
|---|
| Other Names | methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like |
|---|
| Gene, Accession # | MTD2L, Accession: NM_001144978 |
|---|
| Catalog # | TA335893 |
|---|
| Price | |
|---|
| Order / More Info | MTHFD2L Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|