| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TBC1D23 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TBC1D23 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TBC1D23. This antibody reacts with human. The TBC1D23 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TBC1D23 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VDGESPNGSSDRGMKSLVNKMTVALKTKSVNVREKVISFIENTSTPVDRMSFNLPWPDRSCTERHVSSSDRVGKPYRGVKPVFSIGDEEEY |
|---|
| Other Names | DKFZp667G062, HCV non-structural protein 4A-transactivated protein 1, HCV nonstructural protein 4A-transactivated protein 1, TBC1 domain family member 23, TBC1 domain family, member 23 |
|---|
| Gene, Accession # | TBC1D23, Gene ID: 55773 |
|---|
| Catalog # | NBP1-90421 |
|---|
| Price | |
|---|
| Order / More Info | TBC1D23 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|