| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CRX/CORD2 |
|---|
| Clone | 4G11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Chromatin Immunoprecipitation, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for ELISA. ChIP usage reported in scientific literature (PMID 25392503). ICC/IF usage reported in scientific literature (PMID 26563826). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CRX/CORD2 Antibody (4G11) from Novus Biologicals is a mouse monoclonal antibody to CRX/CORD2. This antibody reacts with human, mouse. The CRX/CORD2 Antibody (4G11) has been validated for the following applications: Western Blot, Chromatin Immunoprecipitation, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | CRX (NP_000545, 1 a.a. - 95 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MMAYMNPGPHYSVNALALSGPSVDLMHQAVPYPSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCR |
|---|
| Other Names | cone-rod homeobox, CORD2, CRDcone-rod homeobox protein, LCA7orthodenticle homeobox 3, OTX3 |
|---|
| Gene, Accession # | CRX, Gene ID: 1406, Accession: NP_000545, SwissProt: NP_000545 |
|---|
| Catalog # | H00001406-M02 |
|---|
| Price | |
|---|
| Order / More Info | CRX/CORD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 17656371, 18849347, 19474320, 21738400, 24477073, 24516401, 24912154, 25392503, 25401462, 25417064, 25640818, 26280220, 26563826 |
|---|
| 产品资料 |
|
|