| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PLC-gamma 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PLC-gamma 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PLC-gamma 2. This antibody reacts with human. The PLC-gamma 2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PLC-gamma 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVETKADSIIRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPF |
|---|
| Other Names | EC 3.1.4.11, Phosphoinositide phospholipase C-gamma-2, phospholipase C gamma 2, phospholipase C, gamma 2 (phosphatidylinositol-specific), phospholipase C, gamma 2 (phosphatidylyinositol-specific), Phospholipase C-gamma-2,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2, Phospholipase C-IV, PLCG2, PLC-gamma-2, PLC-IV |
|---|
| Gene, Accession # | PLCG2, Gene ID: 5336 |
|---|
| Catalog # | NBP1-87558 |
|---|
| Price | |
|---|
| Order / More Info | PLC-gamma 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|