| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PLC-gamma 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PLC-gamma 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PLC-gamma 1. This antibody reacts with human. The PLC-gamma 1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PLC-gamma 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SAYEEVPTSMMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAG |
|---|
| Other Names | EC 3.1.4.11, gamma 1 (formerly subtype 148), monophosphatidylinositol phosphodiesterase, NCKAP3,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1, phosphatidylinositol phospholipase C, phosphoinositidase C, phosphoinositide phospholipase C, Phosphoinositide phospholipase C-gamma-1, phospholipase C, gamma 1, phospholipase C-148, Phospholipase C-gamma-1, Phospholipase C-II, PLC11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1, PLC148, PLC-148, PLC-gamma-1, PLC-II1-phosphatidyl-D-myo-inositol-4,5-bisphosphate, triphosphoinositide phosphodiesterase |
|---|
| Gene, Accession # | PLCG1, Gene ID: 5335, Accession: P19174, SwissProt: P19174 |
|---|
| Catalog # | NBP2-38316 |
|---|
| Price | |
|---|
| Order / More Info | PLC-gamma 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|