| Edit |   |
|---|
| Antigenic Specificity | SCAMP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SCAMP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SCAMP1. This antibody reacts with mouse. The SCAMP1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is Scamp1. Peptide sequence GSVKMPNVPNTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKA. |
|---|
| Other Names | secretory carrier membrane protein 1SCAMP37SCAMP, secretory carrier-associated membrane protein 1 |
|---|
| Gene, Accession # | SCAMP1, Gene ID: 9522, Accession: NP_083429 |
|---|
| Catalog # | NBP1-79765-20ul |
|---|
| Price | |
|---|
| Order / More Info | SCAMP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|