| Edit |   |
|---|
| Antigenic Specificity | Ropporin, Rhophilin Associated Protein 1B (ROPN1B) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ROPN1B belongs to the ropporin family and contains 1 RIIa domain. ROPN1B interacts with RHPN1 and AKAP3. It may interact with SPA17. |
|---|
| Immunogen | ROPN1 B antibody was raised using the N terminal of ROPN1 corresponding to a region with amino acids DYFEALSRGETPPVRERSERVALCNWAELTPELLKILHSQVAGRLIIRAE |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | Gene ID: 152015 |
|---|
| Catalog # | ABIN631847 |
|---|
| Price | |
|---|
| Order / More Info | Ropporin, Rhophilin Associated Protein 1B (ROPN1B) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|