| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD2BP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD2BP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD2BP2. This antibody reacts with human. The CD2BP2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CD2BP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MPKRKVTFQGVGDEEDEDEIIVPKKKLVDPVAGSGGPGSRFKGKHSLDSDEE |
|---|
| Other Names | CD2 (cytoplasmic tail) binding protein 2, CD2 antigen (cytoplasmic tail) binding protein 2, CD2 antigen (cytoplasmic tail)-binding protein 2, CD2 antigen cytoplasmic tail-binding protein 2, CD2 binding protein 2, CD2 cytoplasmic domain binding protein 2, CD2 cytoplasmic domain-binding protein 2, CD2 tail-binding protein 2, FWP010, KIAA1178, LIN1, Snu40, U5 snRNP 52K protein, U5-52K |
|---|
| Gene, Accession # | CD2BP2, Gene ID: 10421 |
|---|
| Catalog # | NBP2-49328 |
|---|
| Price | |
|---|
| Order / More Info | CD2BP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|