| 产品详情 |
| Edit |   |
| Antigenic Specificity | Nocturnin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Nocturnin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nocturnin. This antibody reacts with human. The Nocturnin Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Nocturnin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ARSCSRTVCSMGTGTSRLYSALAKTLNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVDLRTDCPSTHPPIRVMQW |
| Other Names | CCR4 carbon catabolite repression 4-like (S. cerevisiae), CCR4 protein homolog, CCR4-like (carbon catabolite repression 4, S.cerevisiae), CCR4LMGC142060, CCR4MGC4120817, MGC142054, MGC78549, NOC, nocturnin |
| Gene, Accession # | CCRN4L, Gene ID: 25819, Accession: Q9UK39, SwissProt: Q9UK39 |
| Catalog # | NBP2-37939 |
| Price | |
| Order / More Info | Nocturnin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|