Edit |   |
Antigenic Specificity | EH-Domain Containing 4 (EHD4) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway. |
Immunogen | EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA |
Other Names | EHD4|past4|PAST4|2210022F10Rik|AI197390|AI846352|AV006278|Past2 |
Gene, Accession # | Gene ID: 30844,98878,192204 |
Catalog # | ABIN631254 |
Price | |
Order / More Info | EH-Domain Containing 4 (EHD4) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |