| Edit |   |
|---|
| Antigenic Specificity | HAUS Augmin-Like Complex, Subunit 6 (HAUS6) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | FAM29A is required for progression through mitosis. FAM29A promotes the nucleation of microtubules from the spindle through recruitment of NEDD1 and gamma-tubulin. |
|---|
| Immunogen | FAM29 A antibody was raised using the middle region of Fam29 corresponding to a region with amino acids RSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLT |
|---|
| Other Names | Dgt6|FAM29A|fam29a|wu:fd21a02|zgc:153242 |
|---|
| Gene, Accession # | Gene ID: 54801 |
|---|
| Catalog # | ABIN632011 |
|---|
| Price | |
|---|
| Order / More Info | HAUS Augmin-Like Complex, Subunit 6 (HAUS6) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|