| 产品详情 |
| Edit |   |
| Antigenic Specificity | MCM6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MCM6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MCM6. This antibody reacts with human. The MCM6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to MCM6(minichromosome maintenance complex component 6) The peptide sequence was selected from the C terminal of MCM6. Peptide sequence RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE. |
| Other Names | DNA replication licensing factor MCM6, EC 3.6.4.12, MCG40308, MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe), MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe) (S.cerevisiae), minichromosome maintenance complex component 6, minichromosome maintenance deficient (mis5, S. pombe) 6, minichromosome maintenance deficient 6 homolog, minichromosome maintenance deficient 6 homolog (S. cerevisiae), Mis5, MIS5 homolog, p105MCM |
| Gene, Accession # | MCM6, Gene ID: 4175, Accession: Q14566, SwissProt: Q14566 |
| Catalog # | NBP1-58075 |
| Price | |
| Order / More Info | MCM6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|