Edit |   |
Antigenic Specificity | SGPP1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 100 ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The SGPP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SGPP1. This antibody reacts with human, mouse. The SGPP1 Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptide directed towards the middle region of human SGPP1. Peptide sequence THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT. |
Other Names | sphingosine-1-phosphate phosphatase 1 |
Gene, Accession # | SGPP1, Gene ID: 81537, Accession: NP_110418, SwissProt: NP_110418 |
Catalog # | NBP1-91353 |
Price | |
Order / More Info | SGPP1 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | PubMed: 25908616, 26556954 |